靶标详情

快速索引

1.General Information
2.Gene Ontology
3.KEGG pathways
4.Sequence
5.Pfam domains
6.Database Cross reference
7.Reference
8.Linked

General Information

ID	TACC1_HUMAN
Name	Transforming acidic coiled-coil-containing protein 1
Synonyms	[Taxin 1, Gastric cancer antigen Ga55]
Function classification
Gene Family	Transforming acidic coiled-coil-containing
Taxonomy	Homo sapiens
Status

Gene Ontology

GO:0007049	cell cycle	BP
GO:0051301	cell division	BP
GO:0005737	cytoplasm	CC
GO:0005634	nucleus	CC
GO:0005515	protein binding	MF

KEGG pathways

Sequence

MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVE

Pfam domains

PF05010

Transforming acidic coiled-coil-containing protein (TACC)

Database Cross Reference

Entrez Gene	TACC1
Ensembl Gene	ENSG00000147526
GeneCards	GC08P038733
Unigene	Hs.279245
RefSeq	NP_001116296.1\|!@#\|NP_006274.2
PharmGKB	PA36299

Reference

10435627	Still I.H., Hamilton M., Vince P., Wolfman A., Cowell J.K.	"Cloning of TACC1, an embryonically expressed, potentially transforming coiled coil containing gene, from the 8p11 breast cancer amplicon."	Oncogene 18:4032-4038(1999).
15207008	Still I.H., Vettaikkorumakankauv A.K., DiMatteo A., Liang P.	"Structure-function evolution of the transforming acidic coiled coil genes revealed by analysis of phylogenetically diverse organisms."	BMC Evol. Biol. 4:16-16(2004).
15489334	The MGC Project Team	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."	Genome Res. 14:2121-2127(2004).
10470851	Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.	"Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."	DNA Res. 6:197-205(1999).
12087473	Line A., Stengrevics A., Slucka Z., Li G., Jankevics E., Rees R.C.	"Serological identification and expression analysis of gastric cancer- associated genes."	Br. J. Cancer 86:1824-1830(2002).
12547166	Line A., Slucka Z., Stengrevics A., Li G., Rees R.C.	"Altered splicing pattern of TACC1 mRNA in gastric cancer."	Cancer Genet. Cytogenet. 139:78-83(2002).
11121038	Gergely F., Karlsson C., Still I.H., Cowell J.K., Kilmartin J., Raff J.W.	"The TACC domain identifies a family of centrosomal proteins that can interact with microtubules."	Proc. Natl. Acad. Sci. U.S.A. 97:14352-14357(2000).
11903063	Lauffart B., Howell S.J., Tasch J.E., Cowell J.K., Still I.H.	"Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells."	Biochem. J. 363:195-200(2002).
12165861	Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D.	"Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators."	Oncogene 21:5619-5630(2002).
14603251	Conte N., Delaval B., Ginestier C., Ferrand A., Isnardon D., Larroque C., Prigent C., Seraphin B., Jacquemier J., Birnbaum D.	"TACC1-chTOG-Aurora A protein complex in breast cancer."	Oncogene 22:8102-8116(2003).
14767476	Gangisetty O., Lauffart B., Sondarva G.V., Chelsea D.M., Still I.H.	"The transforming acidic coiled coil proteins interact with nuclear histone acetyltransferases."	Oncogene 23:2559-2563(2004).
15064709	Delaval B., Ferrand A., Conte N., Larroque C., Hernandez-Verdun D., Prigent C., Birnbaum D.	"Aurora B -TACC1 protein complex in cytokinesis."	Oncogene 23:4516-4522(2004).
15592455	Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.	"Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."	Nat. Biotechnol. 23:94-101(2005).
17081983	Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.	"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."	Cell 127:635-648(2006).
17525332	Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.	"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."	Science 316:1160-1166(2007).

Linked